Lineage for d1sofc_ (1sof C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1264123Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1264992Protein automated matches [190041] (22 species)
    not a true protein
  7. 1265018Species Azotobacter vinelandii [TaxId:354] [186762] (3 PDB entries)
  8. 1265028Domain d1sofc_: 1sof C: [118975]
    Other proteins in same PDB: d1sofa1
    automated match to d1bcfa_
    complexed with ba, fe2, hem, mg

Details for d1sofc_

PDB Entry: 1sof (more details), 2.6 Å

PDB Description: Crystal structure of the azotobacter vinelandii bacterioferritin at 2.6 A resolution
PDB Compounds: (C:) bacterioferritin

SCOPe Domain Sequences for d1sofc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sofc_ a.25.1.1 (C:) automated matches {Azotobacter vinelandii [TaxId: 354]}
mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
edileseedhidwletqldlidkiglenylqsqmd

SCOPe Domain Coordinates for d1sofc_:

Click to download the PDB-style file with coordinates for d1sofc_.
(The format of our PDB-style files is described here.)

Timeline for d1sofc_: