Lineage for d1sn6a2 (1sn6 A:1-80)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1999930Fold a.64: Saposin-like [47861] (2 superfamilies)
    5 helices; folded leaf, closed
  4. 1999931Superfamily a.64.1: Saposin [47862] (5 families) (S)
    Lipid-binding can promote conformational changes and oligomerisation in some members
  5. 1999932Family a.64.1.1: NKL-like [47863] (4 protein domains)
  6. 1999939Protein Saposin C [89077] (1 species)
  7. 1999940Species Human (Homo sapiens) [TaxId:9606] [89078] (11 PDB entries)
  8. 1999960Domain d1sn6a2: 1sn6 A:1-80 [118972]
    Other proteins in same PDB: d1sn6a3
    automated match to d1m12a_

Details for d1sn6a2

PDB Entry: 1sn6 (more details)

PDB Description: NMR solution structure of human Saposin C in SDS micelles
PDB Compounds: (A:) Proactivator polypeptide

SCOPe Domain Sequences for d1sn6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sn6a2 a.64.1.1 (A:1-80) Saposin C {Human (Homo sapiens) [TaxId: 9606]}
sdvycevceflvkevtklidnnktekeildafdkmcsklpkslseecqevvdtygssils
illeevspelvcsmlhlcsg

SCOPe Domain Coordinates for d1sn6a2:

Click to download the PDB-style file with coordinates for d1sn6a2.
(The format of our PDB-style files is described here.)

Timeline for d1sn6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sn6a3