Lineage for d1skxa_ (1skx A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009172Protein Pregnane x receptor, PXR [63624] (1 species)
  7. 2009173Species Human (Homo sapiens) [TaxId:9606] [63625] (15 PDB entries)
  8. 2009180Domain d1skxa_: 1skx A: [118970]
    automated match to d1m13a_
    complexed with rfp

Details for d1skxa_

PDB Entry: 1skx (more details), 2.8 Å

PDB Description: Structural Disorder in the Complex of Human PXR and the Macrolide Antibiotic Rifampicin
PDB Compounds: (A:) orphan nuclear receptor pxr

SCOPe Domain Sequences for d1skxa_:

Sequence, based on SEQRES records: (download)

>d1skxa_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]}
lteeqrmmirelmdaqmktfdttfshfknfrlpgvlssgcelpeslqapsreeaakwsqv
rkdlcslkvslqlrgedgsvwnykppadsggkeifsllphmadmstymfkgiisfakvis
yfrdlpiedqisllkgaafelcqlrfntvfnaetgtwecgrlsycledtaggfqqlllep
mlkfhymlkklqlheeeyvlmqaislfspdrpgvlqhrvvdqlqeqfaitlksyiecnrp
qpahrflflkimamltelrsinaqhtqrllriqdihpfatplmqelfgi

Sequence, based on observed residues (ATOM records): (download)

>d1skxa_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]}
lteeqrmmirelmdaqmktfdttfshfknfrlpgvkvslqlrgedgsvwnykppifsllp
hmadmstymfkgiisfakvisyfrdlpiedqisllkgaafelcqlrfntvfnaetgtwec
grlsyclelllepmlkfhymlkklqlheeeyvlmqaislfspdrpgvlqhrvvdqlqeqf
aitlksyiecnrpqpahrflflkimamltelrsinaqhtqrllriqdihpfatplmqelf
gi

SCOPe Domain Coordinates for d1skxa_:

Click to download the PDB-style file with coordinates for d1skxa_.
(The format of our PDB-style files is described here.)

Timeline for d1skxa_: