![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
![]() | Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) ![]() this domain interrupts the G-protein common fold |
![]() | Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
![]() | Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [47899] (19 PDB entries) |
![]() | Domain d1shzd1: 1shz D:76-200 [118966] Other proteins in same PDB: d1shza2, d1shzc_, d1shzd2, d1shzf_ automatically matched to 1SHZ A:76-200 complexed with alf, gdp, mg |
PDB Entry: 1shz (more details), 2.85 Å
SCOPe Domain Sequences for d1shzd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1shzd1 a.66.1.1 (D:76-200) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} fdqrareefrptiysnvikgmrvlvdareklhipwgdnknqlhgdklmafdtrapmaaqg mvetrvflqylpairalwedsgiqnaydrrrefqlgesvkyfldnldklgvpdyipsqqd illar
Timeline for d1shzd1:
![]() Domains from other chains: (mouse over for more information) d1shza1, d1shza2, d1shzc_, d1shzf_ |