Lineage for d1shzd1 (1shz D:76-200)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1739075Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 1739076Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 1739077Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 1739078Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 1739127Species Norway rat (Rattus norvegicus) [TaxId:10116] [47899] (19 PDB entries)
  8. 1739146Domain d1shzd1: 1shz D:76-200 [118966]
    Other proteins in same PDB: d1shza2, d1shzc_, d1shzd2, d1shzf_
    automatically matched to 1SHZ A:76-200
    complexed with alf, gdp, mg

Details for d1shzd1

PDB Entry: 1shz (more details), 2.85 Å

PDB Description: crystal structure of the p115rhogef rgrgs domain in a complex with galpha(13):galpha(i1) chimera
PDB Compounds: (D:) Guanine Nucleotide-Binding Protein Galpha(13):Galpha(i1) Chimera

SCOPe Domain Sequences for d1shzd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1shzd1 a.66.1.1 (D:76-200) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fdqrareefrptiysnvikgmrvlvdareklhipwgdnknqlhgdklmafdtrapmaaqg
mvetrvflqylpairalwedsgiqnaydrrrefqlgesvkyfldnldklgvpdyipsqqd
illar

SCOPe Domain Coordinates for d1shzd1:

Click to download the PDB-style file with coordinates for d1shzd1.
(The format of our PDB-style files is described here.)

Timeline for d1shzd1: