SCOP 1.73: Domain d1shzd1: 1shz D:76-200

Lineage for d1shzd1 (1shz D:76-200)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47899] (24 PDB entries)

8. Domain d1shzd1: 1shz D:76-200 [118966]
   Other proteins in same PDB: d1shza2, d1shzd2
   automatically matched to 1SHZ A:76-200
   complexed with alf, gdp, mg

Details for d1shzd1

PDB Entry: 1shz, 2.85 Å

PDB Description: crystal structure of the p115rhogef rgrgs domain in a complex with galpha(13):galpha(i1) chimera

PDB Compounds: (D:) Guanine Nucleotide-Binding Protein Galpha(13):Galpha(i1) Chimera

SCOP Domain Sequences for d1shzd1:

Sequence; same for both SEQRES and ATOM records:

>d1shzd1 a.66.1.1 (D:76-200) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus) [TaxId: 10116]}
fdqrareefrptiysnvikgmrvlvdareklhipwgdnknqlhgdklmafdtrapmaaqg
mvetrvflqylpairalwedsgiqnaydrrrefqlgesvkyfldnldklgvpdyipsqqd
illar

Timeline for d1shzd1:

• d1shzd1 is new in SCOP 1.73
  
• d1shzd1 appears in SCOP 1.75
  
• d1shzd1 appears in the current release, SCOPe 2.08