SCOPe 2.06: Domain d1shza1: 1shz A:76-200

Lineage for d1shza1 (1shz A:76-200)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [47899] (19 PDB entries)

8. Domain d1shza1: 1shz A:76-200 [118964]
   Other proteins in same PDB: d1shza2, d1shzc_, d1shzd2, d1shzf_
   complexed with alf, gdp, mg

Details for d1shza1

PDB Entry: 1shz, 2.85 Å

PDB Description: crystal structure of the p115rhogef rgrgs domain in a complex with galpha(13):galpha(i1) chimera

PDB Compounds: (A:) Guanine Nucleotide-Binding Protein Galpha(13):Galpha(i1) Chimera

SCOPe Domain Sequences for d1shza1:

Sequence; same for both SEQRES and ATOM records:

>d1shza1 a.66.1.1 (A:76-200) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fdqrareefrptiysnvikgmrvlvdareklhipwgdnknqlhgdklmafdtrapmaaqg
mvetrvflqylpairalwedsgiqnaydrrrefqlgesvkyfldnldklgvpdyipsqqd
illar

Timeline for d1shza1:

• d1shza1 first appeared in SCOP 1.73
  
• d1shza1 appears in SCOPe 2.05
  
• d1shza1 appears in SCOPe 2.07
  
• d1shza1 appears in the current release, SCOPe 2.08