![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.5: Ephrin ectodomain [74874] (3 proteins) eukaryotic signaling domain probably related to cupredoxins but lacking the metal-binding site automatically mapped to Pfam PF00812 |
![]() | Protein Ephrin-a5 [110105] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [110106] (2 PDB entries) Uniprot O08543 |
![]() | Domain d1shxa_: 1shx A: [118962] automated match to d1shwa_ |
PDB Entry: 1shx (more details), 2.1 Å
SCOPe Domain Sequences for d1shxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1shxa_ b.6.1.5 (A:) Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} vadryavywnssnprfqrgdyhidvcindyldvfcphyedsvpedkteryvlymvnfdgy sacdhtskgfkrwecnrphspngplkfsekfqlftpfslgfefrpgreyfyissaipdng rrsclklkvfvrptnscm
Timeline for d1shxa_: