Lineage for d1sg7a1 (1sg7 A:22-96)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651610Fold a.239: ChaB-like [140375] (1 superfamily)
    3 helices, the first one is shorter than the other two; bundle, capped by a small, C-terminal beta-hairpin
  4. 651611Superfamily a.239.1: ChaB-like [140376] (1 family) (S)
  5. 651612Family a.239.1.1: ChaB-like [140377] (1 protein)
    Pfam PF06150
  6. 651613Protein Putative cation transport regulator ChaB [140378] (1 species)
  7. 651614Species Escherichia coli [TaxId:562] [140379] (1 PDB entry)
  8. 651615Domain d1sg7a1: 1sg7 A:22-96 [118961]

Details for d1sg7a1

PDB Entry: 1sg7 (more details)

PDB Description: nmr solution structure of the putative cation transport regulator chab
PDB Compounds: (A:) Putative Cation transport regulator chaB

SCOP Domain Sequences for d1sg7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sg7a1 a.239.1.1 (A:22-96) Putative cation transport regulator ChaB {Escherichia coli [TaxId: 562]}
pyktksdlpesvkhvlpshaqdiykeafnsawdqykdkedrrddasreetahkvawaavk
heyakgdddkwhkks

SCOP Domain Coordinates for d1sg7a1:

Click to download the PDB-style file with coordinates for d1sg7a1.
(The format of our PDB-style files is described here.)

Timeline for d1sg7a1: