![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.239: ChaB-like [140375] (1 superfamily) 3 helices, the first one is shorter than the other two; bundle, capped by a small, C-terminal beta-hairpin |
![]() | Superfamily a.239.1: ChaB-like [140376] (1 family) ![]() automatically mapped to Pfam PF06150 |
![]() | Family a.239.1.1: ChaB-like [140377] (1 protein) Pfam PF06150 |
![]() | Protein Putative cation transport regulator ChaB [140378] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [140379] (1 PDB entry) Uniprot P0AE63 2-76 |
![]() | Domain d1sg7a1: 1sg7 A:22-96 [118961] |
PDB Entry: 1sg7 (more details)
SCOPe Domain Sequences for d1sg7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sg7a1 a.239.1.1 (A:22-96) Putative cation transport regulator ChaB {Escherichia coli [TaxId: 562]} pyktksdlpesvkhvlpshaqdiykeafnsawdqykdkedrrddasreetahkvawaavk heyakgdddkwhkks
Timeline for d1sg7a1: