Lineage for d1sg7a1 (1sg7 A:22-96)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015896Fold a.239: ChaB-like [140375] (1 superfamily)
    3 helices, the first one is shorter than the other two; bundle, capped by a small, C-terminal beta-hairpin
  4. 2015897Superfamily a.239.1: ChaB-like [140376] (1 family) (S)
    automatically mapped to Pfam PF06150
  5. 2015898Family a.239.1.1: ChaB-like [140377] (1 protein)
    Pfam PF06150
  6. 2015899Protein Putative cation transport regulator ChaB [140378] (1 species)
  7. 2015900Species Escherichia coli [TaxId:562] [140379] (1 PDB entry)
    Uniprot P0AE63 2-76
  8. 2015901Domain d1sg7a1: 1sg7 A:22-96 [118961]

Details for d1sg7a1

PDB Entry: 1sg7 (more details)

PDB Description: NMR solution structure of the putative cation transport regulator ChaB
PDB Compounds: (A:) Putative Cation transport regulator chaB

SCOPe Domain Sequences for d1sg7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sg7a1 a.239.1.1 (A:22-96) Putative cation transport regulator ChaB {Escherichia coli [TaxId: 562]}
pyktksdlpesvkhvlpshaqdiykeafnsawdqykdkedrrddasreetahkvawaavk
heyakgdddkwhkks

SCOPe Domain Coordinates for d1sg7a1:

Click to download the PDB-style file with coordinates for d1sg7a1.
(The format of our PDB-style files is described here.)

Timeline for d1sg7a1: