Lineage for d1sg5a1 (1sg5 A:1-86)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2433507Fold b.137: Rof/RNase P subunit-like [101743] (1 superfamily)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold
  4. 2433508Superfamily b.137.1: Rof/RNase P subunit-like [101744] (2 families) (S)
  5. 2433522Family b.137.1.2: Rof-like [141305] (1 protein)
    Pfam PF07073; ROF
  6. 2433523Protein Inhibitor of Rho Rof [141306] (1 species)
    formerly hypothetical protein YaeO
  7. 2433524Species Escherichia coli [TaxId:562] [141307] (1 PDB entry)
    Uniprot P0AFW8 1-86
  8. 2433525Domain d1sg5a1: 1sg5 A:1-86 [118960]

Details for d1sg5a1

PDB Entry: 1sg5 (more details)

PDB Description: solution structure of yaeo, a rho-specific inhibitor of transcription termination
PDB Compounds: (A:) orf, hypothetical protein

SCOPe Domain Sequences for d1sg5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sg5a1 b.137.1.2 (A:1-86) Inhibitor of Rho Rof {Escherichia coli [TaxId: 562]}
msmndtyqpincddydnlelacqhhlmltlelkdgeklqakasdlvsrknveylvveaag
etrelrldkitsfshpeigtvvvses

SCOPe Domain Coordinates for d1sg5a1:

Click to download the PDB-style file with coordinates for d1sg5a1.
(The format of our PDB-style files is described here.)

Timeline for d1sg5a1: