![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.137: Rof/RNase P subunit-like [101743] (1 superfamily) core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold |
![]() | Superfamily b.137.1: Rof/RNase P subunit-like [101744] (2 families) ![]() |
![]() | Family b.137.1.2: Rof-like [141305] (1 protein) Pfam PF07073; ROF |
![]() | Protein Inhibitor of Rho Rof [141306] (1 species) formerly hypothetical protein YaeO |
![]() | Species Escherichia coli [TaxId:562] [141307] (1 PDB entry) Uniprot P0AFW8 1-86 |
![]() | Domain d1sg5a1: 1sg5 A:1-86 [118960] |
PDB Entry: 1sg5 (more details)
SCOPe Domain Sequences for d1sg5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sg5a1 b.137.1.2 (A:1-86) Inhibitor of Rho Rof {Escherichia coli [TaxId: 562]} msmndtyqpincddydnlelacqhhlmltlelkdgeklqakasdlvsrknveylvveaag etrelrldkitsfshpeigtvvvses
Timeline for d1sg5a1: