![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (4 families) ![]() |
![]() | Family c.14.1.3: Crotonase-like [52103] (13 proteins) |
![]() | Protein Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) [52108] (4 species) |
![]() | Species Human (Homo sapiens), mitochondrial [TaxId:9606] [141999] (1 PDB entry) Uniprot P42126 44-292 |
![]() | Domain d1sg4c1: 1sg4 C:3-250 [118959] automatically matched to 1SG4 A:2-250 complexed with co8 |
PDB Entry: 1sg4 (more details), 1.3 Å
SCOP Domain Sequences for d1sg4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sg4c1 c.14.1.3 (C:3-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} qrvlvepdagagvavmkfknppvnslslefltelvisleklendksfrgviltsdrpgvf sagldltemcgrspahyagywkavqelwlrlyqsnlvlvsaingacpaggclvaltcdyr iladnpryciglnetqlgiiapfwlkdtlentighraaeralqlgllfppaealqvgivd qvvpeeqvqstalsaiaqwmaipdharqltkammrkatasrlvtqrdadvqnfvsfiskd siqkslqm
Timeline for d1sg4c1: