SCOP 1.75: Domain d1sg4b1: 1sg4 B:3-250

Lineage for d1sg4b1 (1sg4 B:3-250)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (4 families)

5. Family c.14.1.3: Crotonase-like [52103] (13 proteins)

6. Protein Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) [52108] (4 species)

7. Species Human (Homo sapiens), mitochondrial [TaxId:9606] [141999] (1 PDB entry)
   Uniprot P42126 44-292

8. Domain d1sg4b1: 1sg4 B:3-250 [118958]
   automatically matched to 1SG4 A:2-250
   complexed with co8

Details for d1sg4b1

PDB Entry: 1sg4, 1.3 Å

PDB Description: Crystal structure of human mitochondrial delta3-delta2-enoyl-CoA isomerase

PDB Compounds: (B:) 3,2-trans-enoyl-CoA isomerase, mitochondrial

SCOP Domain Sequences for d1sg4b1:

Sequence; same for both SEQRES and ATOM records:

>d1sg4b1 c.14.1.3 (B:3-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
qrvlvepdagagvavmkfknppvnslslefltelvisleklendksfrgviltsdrpgvf
sagldltemcgrspahyagywkavqelwlrlyqsnlvlvsaingacpaggclvaltcdyr
iladnpryciglnetqlgiiapfwlkdtlentighraaeralqlgllfppaealqvgivd
qvvpeeqvqstalsaiaqwmaipdharqltkammrkatasrlvtqrdadvqnfvsfiskd
siqkslqm

Timeline for d1sg4b1:

• d1sg4b1 first appeared in SCOP 1.73
  
• d1sg4b1 is called d1sg4b_ in SCOPe 2.01
  
• d1sg4b1 appears in the current release, SCOPe 2.08, called d1sg4b_