SCOPe 2.07: Domain d1sg0b_: 1sg0 B:

Lineage for d1sg0b_ (1sg0 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.3: Quinone reductase [52235] (4 proteins)
   binds FAD

6. Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52241] (66 PDB entries)

8. Domain d1sg0b_: 1sg0 B: [118956]
   automated match to d1qr2a_
   complexed with fad, stl, zn

Details for d1sg0b_

PDB Entry: 1sg0, 1.5 Å

PDB Description: Crystal structure analysis of QR2 in complex with resveratrol

PDB Compounds: (B:) nrh dehydrogenase [quinone] 2

SCOPe Domain Sequences for d1sg0b_:

Sequence; same for both SEQRES and ATOM records:

>d1sg0b_ c.23.5.3 (B:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq

Timeline for d1sg0b_:

• d1sg0b_ first appeared in SCOP 1.73, called d1sg0b1
  
• d1sg0b_ appears in SCOPe 2.06
  
• d1sg0b_ appears in the current release, SCOPe 2.08