Lineage for d1seua3 (1seu A:201-430)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3018472Fold e.15: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56740] (1 superfamily)
    2 domains: alpha+beta and all-beta
  4. 3018473Superfamily e.15.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56741] (1 family) (S)
    automatically mapped to Pfam PF02919
  5. 3018474Family e.15.1.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56742] (1 protein)
  6. 3018475Protein Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56743] (2 species)
  7. 3018478Species Human (Homo sapiens) [TaxId:9606] [56744] (15 PDB entries)
    Uniprot P11387 203-765 ! Uniprot P11387 203-767
  8. 3018487Domain d1seua3: 1seu A:201-430 [118954]
    Other proteins in same PDB: d1seua1, d1seua2
    automatically matched to d1k4sa2
    protein/DNA complex; complexed with sa3

Details for d1seua3

PDB Entry: 1seu (more details), 3 Å

PDB Description: human dna topoisomerase i (70 kda) in complex with the indolocarbazole sa315f and covalent complex with a 22 base pair dna duplex
PDB Compounds: (A:) DNA topoisomerase I

SCOPe Domain Sequences for d1seua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1seua3 e.15.1.1 (A:201-430) Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment {Human (Homo sapiens) [TaxId: 9606]}
qkwkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatff
akmldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqms
keeklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpe
diiincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimln

SCOPe Domain Coordinates for d1seua3:

Click to download the PDB-style file with coordinates for d1seua3.
(The format of our PDB-style files is described here.)

Timeline for d1seua3: