Lineage for d1seua2 (1seu A:431-633,A:714-765)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2605773Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 2605774Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 2605876Family d.163.1.2: Eukaryotic DNA topoisomerase I, catalytic core [56361] (1 protein)
  6. 2605877Protein Eukaryotic DNA topoisomerase I, catalytic core [56362] (2 species)
  7. 2605878Species Human (Homo sapiens) [TaxId:9606] [56363] (15 PDB entries)
    Uniprot P11387 203-765 ! Uniprot P11387 203-767
  8. 2605887Domain d1seua2: 1seu A:431-633,A:714-765 [118953]
    Other proteins in same PDB: d1seua1, d1seua3
    automatically matched to d1ej9a1
    protein/DNA complex; complexed with sa3

Details for d1seua2

PDB Entry: 1seu (more details), 3 Å

PDB Description: human dna topoisomerase i (70 kda) in complex with the indolocarbazole sa315f and covalent complex with a 22 base pair dna duplex
PDB Compounds: (A:) DNA topoisomerase I

SCOPe Domain Sequences for d1seua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1seua2 d.163.1.2 (A:431-633,A:714-765) Eukaryotic DNA topoisomerase I, catalytic core {Human (Homo sapiens) [TaxId: 9606]}
pssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalrag
nekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfkn
lqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapde
nipakilsynranravailcnhqXialgtsklsyldpritvawckkwgvpiekiynktqr
ekfawaidmadedyef

SCOPe Domain Coordinates for d1seua2:

Click to download the PDB-style file with coordinates for d1seua2.
(The format of our PDB-style files is described here.)

Timeline for d1seua2: