SCOPe 2.06: Domain d1sdqa_: 1sdq A:

Lineage for d1sdqa_ (1sdq A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (198 PDB entries)
   Uniprot P00431

8. Domain d1sdqa_: 1sdq A: [118951]
   automated match to d1koka_
   complexed with fmi, no

Details for d1sdqa_

PDB Entry: 1sdq, 1.69 Å

PDB Description: structure of reduced-no adduct of mesopone cytochrome c peroxidase

PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d1sdqa_:

Sequence; same for both SEQRES and ATOM records:

>d1sdqa_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d1sdqa_:

• d1sdqa_ first appeared in SCOP 1.73, called d1sdqa1
  
• d1sdqa_ appears in SCOPe 2.05
  
• d1sdqa_ appears in SCOPe 2.07
  
• d1sdqa_ appears in the current release, SCOPe 2.08