SCOP 1.75: Domain d1sdqa1: 1sdq A:1-294

Lineage for d1sdqa1 (1sdq A:1-294)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families)

5. Family a.93.1.1: CCP-like [48114] (4 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (123 PDB entries)
   Uniprot P00431

8. Domain d1sdqa1: 1sdq A:1-294 [118951]
   automatically matched to d1koka_
   complexed with fmi, no

Details for d1sdqa1

PDB Entry: 1sdq, 1.69 Å

PDB Description: structure of reduced-no adduct of mesopone cytochrome c peroxidase

PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOP Domain Sequences for d1sdqa1:

Sequence; same for both SEQRES and ATOM records:

>d1sdqa1 a.93.1.1 (A:1-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d1sdqa1:

• d1sdqa1 first appeared in SCOP 1.73
  
• d1sdqa1 is called d1sdqa_ in SCOPe 2.01
  
• d1sdqa1 appears in the current release, SCOPe 2.08, called d1sdqa_