Lineage for d1sdna2 (1sdn A:3-262)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2618351Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2619171Protein Penicillin-binding protein 5, N-terminal domain [69875] (1 species)
  7. 2619172Species Escherichia coli [TaxId:562] [69876] (11 PDB entries)
  8. 2619183Domain d1sdna2: 1sdn A:3-262 [118950]
    Other proteins in same PDB: d1sdna1
    automated match to d1nj4a2
    complexed with hg; mutant

Details for d1sdna2

PDB Entry: 1sdn (more details), 2.5 Å

PDB Description: crystal structure of a deacylation-defective mutant of penicillin- binding protein 5 modified by mercury
PDB Compounds: (A:) penicillin-binding protein 5

SCOPe Domain Sequences for d1sdna2:

Sequence, based on SEQRES records: (download)

>d1sdna2 e.3.1.1 (A:3-262) Penicillin-binding protein 5, N-terminal domain {Escherichia coli [TaxId: 562]}
lniktmipgvpqidaesyilidynsgkvlaeqnadvrrdpasltkmmtsyvigqamkagk
fketdlvtigndawatgnpvfkgsslmflkpgmqvpvsqlirdinlqsgndacvamadfa
agsqdafvglmnsyvnalglknthfqtvhgldadgqyssardmaligqalirdvpneysi
ykekeftfngirqlnrngllwdnslnvdgiktghtdkagynlvasategqmrlisavmgg
rtfkgreaeskklltwgfrf

Sequence, based on observed residues (ATOM records): (download)

>d1sdna2 e.3.1.1 (A:3-262) Penicillin-binding protein 5, N-terminal domain {Escherichia coli [TaxId: 562]}
lniktmipgvpqidaesyilidynsgkvlaeqnadvrrdpasltkmmtsyvigqamkagk
fketdlvtigndawatgsslmflkpgmqvpvsqlirdinlqsgndacvamadfaagsqda
fvglmnsyvnalglknthfqtvhgldadgqyssardmaligqalirdvpneysiykekef
tfngirqlnrngllwdnslnvdgiktghtdkagynlvasategqmrlisavmggrtfkgr
eaeskklltwgfrf

SCOPe Domain Coordinates for d1sdna2:

Click to download the PDB-style file with coordinates for d1sdna2.
(The format of our PDB-style files is described here.)

Timeline for d1sdna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sdna1