Lineage for d1sc7a3 (1sc7 A:201-430)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1953326Fold e.15: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56740] (1 superfamily)
    2 domains: alpha+beta and all-beta
  4. 1953327Superfamily e.15.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56741] (1 family) (S)
    automatically mapped to Pfam PF02919
  5. 1953328Family e.15.1.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56742] (1 protein)
  6. 1953329Protein Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56743] (2 species)
  7. 1953332Species Human (Homo sapiens) [TaxId:9606] [56744] (15 PDB entries)
    Uniprot P11387 203-765 ! Uniprot P11387 203-767
  8. 1953340Domain d1sc7a3: 1sc7 A:201-430 [118946]
    Other proteins in same PDB: d1sc7a1, d1sc7a2
    automatically matched to d1k4sa2
    protein/DNA complex; complexed with m38, pg4

Details for d1sc7a3

PDB Entry: 1sc7 (more details), 3 Å

PDB Description: Human DNA Topoisomerase I (70 Kda) In Complex With The Indenoisoquinoline MJ-II-38 and Covalent Complex With A 22 Base Pair DNA Duplex
PDB Compounds: (A:) DNA topoisomerase I

SCOPe Domain Sequences for d1sc7a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sc7a3 e.15.1.1 (A:201-430) Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment {Human (Homo sapiens) [TaxId: 9606]}
qkwkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatff
akmldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqms
keeklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpe
diiincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimln

SCOPe Domain Coordinates for d1sc7a3:

Click to download the PDB-style file with coordinates for d1sc7a3.
(The format of our PDB-style files is described here.)

Timeline for d1sc7a3: