Lineage for d1sc7a1 (1sc7 A:636-712)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1476004Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1476243Superfamily a.2.8: Eukaryotic DNA topoisomerase I, dispensable insert domain [46596] (1 family) (S)
  5. 1476244Family a.2.8.1: Eukaryotic DNA topoisomerase I, dispensable insert domain [46597] (1 protein)
  6. 1476245Protein Eukaryotic DNA topoisomerase I, dispensable insert domain [46598] (1 species)
  7. 1476246Species Human (Homo sapiens) [TaxId:9606] [46599] (9 PDB entries)
    Uniprot P11387 203-767
  8. 1476250Domain d1sc7a1: 1sc7 A:636-712 [118944]
    Other proteins in same PDB: d1sc7a2, d1sc7a3
    automatically matched to d1rrja1
    protein/DNA complex; complexed with m38, pg4

Details for d1sc7a1

PDB Entry: 1sc7 (more details), 3 Å

PDB Description: Human DNA Topoisomerase I (70 Kda) In Complex With The Indenoisoquinoline MJ-II-38 and Covalent Complex With A 22 Base Pair DNA Duplex
PDB Compounds: (A:) DNA topoisomerase I

SCOPe Domain Sequences for d1sc7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sc7a1 a.2.8.1 (A:636-712) Eukaryotic DNA topoisomerase I, dispensable insert domain {Human (Homo sapiens) [TaxId: 9606]}
ppktfeksmmnlqtkidakkeqladarrdlksakadakvmkdaktkkvveskkkavqrle
eqlmklevqatdreenk

SCOPe Domain Coordinates for d1sc7a1:

Click to download the PDB-style file with coordinates for d1sc7a1.
(The format of our PDB-style files is described here.)

Timeline for d1sc7a1: