Class a: All alpha proteins [46456] (285 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.8: Eukaryotic DNA topoisomerase I, dispensable insert domain [46596] (1 family) |
Family a.2.8.1: Eukaryotic DNA topoisomerase I, dispensable insert domain [46597] (1 protein) |
Protein Eukaryotic DNA topoisomerase I, dispensable insert domain [46598] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [46599] (9 PDB entries) Uniprot P11387 203-767 |
Domain d1sc7a1: 1sc7 A:636-712 [118944] Other proteins in same PDB: d1sc7a2, d1sc7a3 automatically matched to d1rrja1 protein/DNA complex; complexed with m38, pg4 |
PDB Entry: 1sc7 (more details), 3 Å
SCOPe Domain Sequences for d1sc7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sc7a1 a.2.8.1 (A:636-712) Eukaryotic DNA topoisomerase I, dispensable insert domain {Human (Homo sapiens) [TaxId: 9606]} ppktfeksmmnlqtkidakkeqladarrdlksakadakvmkdaktkkvveskkkavqrle eqlmklevqatdreenk
Timeline for d1sc7a1: