| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (14 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
| Family d.58.18.1: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55022] (1 protein) |
| Protein Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55023] (2 species) |
| Species Escherichia coli [TaxId:562] [55024] (7 PDB entries) |
| Domain d1sc6c3: 1sc6 C:327-410 [118940] Other proteins in same PDB: d1sc6a1, d1sc6a2, d1sc6b1, d1sc6b2, d1sc6c1, d1sc6c2, d1sc6d1, d1sc6d2 automatically matched to d1psda3 complexed with nad; mutant |
PDB Entry: 1sc6 (more details), 2.09 Å
SCOP Domain Sequences for d1sc6c3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sc6c3 d.58.18.1 (C:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]}
fpevslplhggrrlmhihenrpgvltalnkifaeqgvniaaqylqtsaqmgyvvidiead
edvaekalqamkaipgtirarlly
Timeline for d1sc6c3: