Lineage for d1sc6c3 (1sc6 C:327-410)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954059Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2954060Family d.58.18.1: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55022] (1 protein)
  6. 2954061Protein Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55023] (2 species)
  7. 2954062Species Escherichia coli [TaxId:562] [55024] (7 PDB entries)
  8. 2954065Domain d1sc6c3: 1sc6 C:327-410 [118940]
    Other proteins in same PDB: d1sc6a1, d1sc6a2, d1sc6b1, d1sc6b2, d1sc6c1, d1sc6c2, d1sc6d1, d1sc6d2
    automatically matched to d1psda3
    complexed with nad

Details for d1sc6c3

PDB Entry: 1sc6 (more details), 2.09 Å

PDB Description: crystal structure of w139g d-3-phosphoglycerate dehydrogenase complexed with nad+
PDB Compounds: (C:) D-3-phosphoglycerate dehydrogenase

SCOPe Domain Sequences for d1sc6c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sc6c3 d.58.18.1 (C:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]}
fpevslplhggrrlmhihenrpgvltalnkifaeqgvniaaqylqtsaqmgyvvidiead
edvaekalqamkaipgtirarlly

SCOPe Domain Coordinates for d1sc6c3:

Click to download the PDB-style file with coordinates for d1sc6c3.
(The format of our PDB-style files is described here.)

Timeline for d1sc6c3: