Lineage for d1sc6c1 (1sc6 C:108-291)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844156Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 2844227Protein Phosphoglycerate dehydrogenase [51839] (2 species)
    has additional C-terminal domain of the ferredoxin fold
  7. 2844228Species Escherichia coli [TaxId:562] [51840] (7 PDB entries)
  8. 2844231Domain d1sc6c1: 1sc6 C:108-291 [118938]
    Other proteins in same PDB: d1sc6a2, d1sc6a3, d1sc6b2, d1sc6b3, d1sc6c2, d1sc6c3, d1sc6d2, d1sc6d3
    automatically matched to d1psda1
    complexed with nad

Details for d1sc6c1

PDB Entry: 1sc6 (more details), 2.09 Å

PDB Description: crystal structure of w139g d-3-phosphoglycerate dehydrogenase complexed with nad+
PDB Compounds: (C:) D-3-phosphoglycerate dehydrogenase

SCOPe Domain Sequences for d1sc6c1:

Sequence, based on SEQRES records: (download)

>d1sc6c1 c.2.1.4 (C:108-291) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]}
ntrsvaelvigelllllrgvpeanakahrgvgnklaagsfeargkklgiigyghigtqlg
ilaeslgmyvyfydienklplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeis
lmkpgsllinasrgtvvdipaladalaskhlagaaidvfptepatnsdpftsplaefdnv
lltp

Sequence, based on observed residues (ATOM records): (download)

>d1sc6c1 c.2.1.4 (C:108-291) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]}
ntrsvaelvigelllllrgvpeanakahrgvgngsfeargkklgiigyghigtqlgilae
slgmyvyfydienklplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkp
gsllinasrgtvvdipaladalaskhlagaaidvsplaefdnvlltp

SCOPe Domain Coordinates for d1sc6c1:

Click to download the PDB-style file with coordinates for d1sc6c1.
(The format of our PDB-style files is described here.)

Timeline for d1sc6c1: