Lineage for d1sc6b1 (1sc6 B:108-295)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 687750Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 687821Protein Phosphoglycerate dehydrogenase [51839] (2 species)
    has additional C-terminal domain of the ferredoxin fold
  7. 687822Species Escherichia coli [TaxId:562] [51840] (7 PDB entries)
  8. 687824Domain d1sc6b1: 1sc6 B:108-295 [118935]
    Other proteins in same PDB: d1sc6a2, d1sc6a3, d1sc6b2, d1sc6b3, d1sc6c2, d1sc6c3, d1sc6d2, d1sc6d3
    automatically matched to d1psda1
    complexed with nad; mutant

Details for d1sc6b1

PDB Entry: 1sc6 (more details), 2.09 Å

PDB Description: crystal structure of w139g d-3-phosphoglycerate dehydrogenase complexed with nad+
PDB Compounds: (B:) D-3-phosphoglycerate dehydrogenase

SCOP Domain Sequences for d1sc6b1:

Sequence, based on SEQRES records: (download)

>d1sc6b1 c.2.1.4 (B:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]}
ntrsvaelvigelllllrgvpeanakahrgvgnklaagsfeargkklgiigyghigtqlg
ilaeslgmyvyfydienklplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeis
lmkpgsllinasrgtvvdipaladalaskhlagaaidvfptepatnsdpftsplaefdnv
lltphigg

Sequence, based on observed residues (ATOM records): (download)

>d1sc6b1 c.2.1.4 (B:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]}
ntrsvaelvigelllllrgvpeanakahrgvgnsfeargkklgiigyghigtqlgilaes
lgmyvyfydienklplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpg
sllinasrgtvvdipaladalaskhlagaaidsplaefdnvlltphigg

SCOP Domain Coordinates for d1sc6b1:

Click to download the PDB-style file with coordinates for d1sc6b1.
(The format of our PDB-style files is described here.)

Timeline for d1sc6b1: