Lineage for d1sc6a3 (1sc6 A:327-410)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725281Superfamily d.58.18: ACT-like [55021] (12 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 725282Family d.58.18.1: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55022] (1 protein)
  6. 725283Protein Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55023] (2 species)
  7. 725284Species Escherichia coli [TaxId:562] [55024] (7 PDB entries)
  8. 725285Domain d1sc6a3: 1sc6 A:327-410 [118934]
    Other proteins in same PDB: d1sc6a1, d1sc6a2, d1sc6b1, d1sc6b2, d1sc6c1, d1sc6c2, d1sc6d1, d1sc6d2
    automatically matched to d1psda3
    complexed with nad; mutant

Details for d1sc6a3

PDB Entry: 1sc6 (more details), 2.09 Å

PDB Description: crystal structure of w139g d-3-phosphoglycerate dehydrogenase complexed with nad+
PDB Compounds: (A:) D-3-phosphoglycerate dehydrogenase

SCOP Domain Sequences for d1sc6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]}
fpevslplhggrrlmhihenrpgvltalnkifaeqgvniaaqylqtsaqmgyvvidiead
edvaekalqamkaipgtirarlly

SCOP Domain Coordinates for d1sc6a3:

Click to download the PDB-style file with coordinates for d1sc6a3.
(The format of our PDB-style files is described here.)

Timeline for d1sc6a3: