| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) ![]() |
| Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins) this domain is interrupted by the Rossmann-fold domain |
| Protein Phosphoglycerate dehydrogenase [52293] (2 species) has additional C-terminal domain of the ferredoxin fold |
| Species Escherichia coli [TaxId:562] [52294] (7 PDB entries) |
| Domain d1sc6a2: 1sc6 A:7-107,A:296-326 [118933] Other proteins in same PDB: d1sc6a1, d1sc6a3, d1sc6b1, d1sc6b3, d1sc6c1, d1sc6c3, d1sc6d1, d1sc6d3 automatically matched to d1psda2 complexed with nad |
PDB Entry: 1sc6 (more details), 2.09 Å
SCOPe Domain Sequences for d1sc6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sc6a2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]}
ekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthlt
edvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsXstqeaqeniglevagkli
kysdngstlsavn
Timeline for d1sc6a2: