Lineage for d1sbyb_ (1sby B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2450336Protein Drosophila alcohol dehydrogenase [51782] (2 species)
  7. 2450337Species Fly (Drosophila lebanonensis) [TaxId:7225] [51783] (8 PDB entries)
  8. 2450339Domain d1sbyb_: 1sby B: [118931]
    automated match to d1a4ua_
    complexed with etf, nad

Details for d1sbyb_

PDB Entry: 1sby (more details), 1.1 Å

PDB Description: Alcohol dehydrogenase from Drosophila lebanonensis complexed with NAD+ and 2,2,2-trifluoroethanol at 1.1 A resolution
PDB Compounds: (B:) alcohol dehydrogenase

SCOPe Domain Sequences for d1sbyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sbyb_ c.2.1.2 (B:) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]}
mdltnknvifvaalggigldtsrelvkrnlknfvildrvenptalaelkainpkvnitfh
tydvtvpvaeskkllkkifdqlktvdilingagilddhqiertiainftglvntttaild
fwdkrkggpggiianicsvtgfnaihqvpvysaskaavvsftnslaklapitgvtaysin
pgitrtplvhtfnswldveprvaelllshptqtseqcgqnfvkaieankngaiwkldlgt
leaiewtkhwdshi

SCOPe Domain Coordinates for d1sbyb_:

Click to download the PDB-style file with coordinates for d1sbyb_.
(The format of our PDB-style files is described here.)

Timeline for d1sbyb_: