Lineage for d1sbya1 (1sby A:1-254)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 686289Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 686603Protein Drosophila alcohol dehydrogenase [51782] (2 species)
  7. 686604Species Fly (Drosophila lebanonensis) [TaxId:7225] [51783] (6 PDB entries)
  8. 686605Domain d1sbya1: 1sby A:1-254 [118930]
    automatically matched to d1a4ua_
    complexed with etf, nad

Details for d1sbya1

PDB Entry: 1sby (more details), 1.1 Å

PDB Description: Alcohol dehydrogenase from Drosophila lebanonensis complexed with NAD+ and 2,2,2-trifluoroethanol at 1.1 A resolution
PDB Compounds: (A:) alcohol dehydrogenase

SCOP Domain Sequences for d1sbya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]}
mdltnknvifvaalggigldtsrelvkrnlknfvildrvenptalaelkainpkvnitfh
tydvtvpvaeskkllkkifdqlktvdilingagilddhqiertiainftglvntttaild
fwdkrkggpggiianicsvtgfnaihqvpvysaskaavvsftnslaklapitgvtaysin
pgitrtplvhtfnswldveprvaelllshptqtseqcgqnfvkaieankngaiwkldlgt
leaiewtkhwdshi

SCOP Domain Coordinates for d1sbya1:

Click to download the PDB-style file with coordinates for d1sbya1.
(The format of our PDB-style files is described here.)

Timeline for d1sbya1: