SCOPe 2.08: Domain d1saza2: 1saz A:173-375

Lineage for d1saza2 (1saz A:173-375)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.2: Acetokinase-like [53080] (4 proteins)

6. Protein butyrate kinase 2 [142460] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [142461] (2 PDB entries)
   Uniprot Q9X278 1-172! Uniprot Q9X278 173-375

8. Domain d1saza2: 1saz A:173-375 [118926]
   complexed with acp, fmt, na

Details for d1saza2

PDB Entry: 1saz, 2.5 Å

PDB Description: Membership in the ASKHA Superfamily: Enzymological Properties and Crystal Structure of Butyrate Kinase 2 from Thermotoga maritima

PDB Compounds: (A:) Probable butyrate kinase 2

SCOPe Domain Sequences for d1saza2:

Sequence; same for both SEQRES and ATOM records:

>d1saza2 c.55.1.2 (A:173-375) butyrate kinase 2 {Thermotoga maritima [TaxId: 2336]}
yeemnlvvahmgggisiaahrkgrvidvnnaldgdgpftpersgtlpltqlvdlcfsgkf
tyeemkkrivgngglvaylgtsdarevvrrikqgdewakrvyramayqiakwigkmaavl
kgevdfivltgglahekeflvpwitkrvsfiapvlvfpgsneekalalsalrvlrgeekp
knyseesrrwrerydsyldgilr

Timeline for d1saza2:

• d1saza2 first appeared in SCOP 1.73
  
• d1saza2 appears in SCOPe 2.07