SCOP 1.73: Domain d1saza1: 1saz A:1-172

Lineage for d1saza1 (1saz A:1-172)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families)
   duplication contains two domains of this fold

5. Family c.55.1.2: Acetokinase-like [53080] (3 proteins)

6. Protein butyrate kinase 2 [142460] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [142461] (2 PDB entries)

8. Domain d1saza1: 1saz A:1-172 [118925]
   complexed with acp, fmt, na

Details for d1saza1

PDB Entry: 1saz, 2.5 Å

PDB Description: Membership in the ASKHA Superfamily: Enzymological Properties and Crystal Structure of Butyrate Kinase 2 from Thermotoga maritima

PDB Compounds: (A:) Probable butyrate kinase 2

SCOP Domain Sequences for d1saza1:

Sequence; same for both SEQRES and ATOM records:

>d1saza1 c.55.1.2 (A:1-172) butyrate kinase 2 {Thermotoga maritima [TaxId: 2336]}
mfriltinpgststklsifedermvkmqnfshspdelgrfqkildqlefrekiarqfvee
tgyslssfsafvsrgglldpipggvylvdglmiktlksgkngehasnlgaiiahrfsset
gvpayvvdpvvvdemedvarvsghpnyqrksifhalnqktvakevarmmnkr

Timeline for d1saza1:

• d1saza1 is new in SCOP 1.73
  
• d1saza1 appears in SCOP 1.75
  
• d1saza1 appears in the current release, SCOPe 2.08