Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) duplication contains two domains of this fold |
Family c.55.1.2: Acetokinase-like [53080] (3 proteins) |
Protein butyrate kinase 2 [142460] (1 species) |
Species Thermotoga maritima [TaxId:2336] [142461] (2 PDB entries) |
Domain d1saza1: 1saz A:1-172 [118925] complexed with acp, fmt, na |
PDB Entry: 1saz (more details), 2.5 Å
SCOP Domain Sequences for d1saza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1saza1 c.55.1.2 (A:1-172) butyrate kinase 2 {Thermotoga maritima [TaxId: 2336]} mfriltinpgststklsifedermvkmqnfshspdelgrfqkildqlefrekiarqfvee tgyslssfsafvsrgglldpipggvylvdglmiktlksgkngehasnlgaiiahrfsset gvpayvvdpvvvdemedvarvsghpnyqrksifhalnqktvakevarmmnkr
Timeline for d1saza1: