SCOPe 2.01: Domain d1s9kc2: 1s9k C:399-575

Lineage for d1s9kc2 (1s9k C:399-575)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (7 families)

5. Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins)

6. Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries)

8. Domain d1s9kc2: 1s9k C:399-575 [118922]
   Other proteins in same PDB: d1s9kc1, d1s9kd1, d1s9ke1
   automatically matched to d1p7hl2
   protein/DNA complex

Details for d1s9kc2

PDB Entry: 1s9k, 3.1 Å

PDB Description: Crystal Structure of Human NFAT1 and Fos-Jun on the IL-2 ARRE1 Site

PDB Compounds: (C:) Nuclear factor of activated T-cells, cytoplasmic 2

SCOPe Domain Sequences for d1s9kc2:

Sequence; same for both SEQRES and ATOM records:

>d1s9kc2 b.2.5.3 (C:399-575) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
wplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkplglqi
figtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratidcagi
lklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqrsah

Timeline for d1s9kc2:

• d1s9kc2 first appeared in SCOP 1.73
  
• d1s9kc2 appears in SCOP 1.75
  
• d1s9kc2 appears in SCOPe 2.02
  
• d1s9kc2 appears in the current release, SCOPe 2.08