Lineage for d1s9kc2 (1s9k C:399-575)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 659309Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 659552Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 659607Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins)
  6. 659650Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species)
  7. 659651Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries)
  8. 659666Domain d1s9kc2: 1s9k C:399-575 [118922]
    Other proteins in same PDB: d1s9kc1
    automatically matched to d1p7hl2

Details for d1s9kc2

PDB Entry: 1s9k (more details), 3.1 Å

PDB Description: Crystal Structure of Human NFAT1 and Fos-Jun on the IL-2 ARRE1 Site
PDB Compounds: (C:) Nuclear factor of activated T-cells, cytoplasmic 2

SCOP Domain Sequences for d1s9kc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s9kc2 b.2.5.3 (C:399-575) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
wplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkplglqi
figtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratidcagi
lklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqrsah

SCOP Domain Coordinates for d1s9kc2:

Click to download the PDB-style file with coordinates for d1s9kc2.
(The format of our PDB-style files is described here.)

Timeline for d1s9kc2: