Lineage for d1s9ci2 (1s9c I:10-163)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858616Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 858617Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 858756Family d.38.1.4: MaoC-like [82636] (6 proteins)
  6. 858761Protein 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase [102907] (2 species)
    duplication: consists of two MaoC-like domains; there is a greater structural divergence in the N-terminal domain
  7. 858762Species Human (Homo sapiens) [TaxId:9606] [143168] (1 PDB entry)
    Uniprot P51659 326-479! Uniprot P51659 480-605
    the structure of N-terminal, SDR domain is also known, PDB entry 1ZBQ
  8. 858780Domain d1s9ci2: 1s9c I:10-163 [118906]
    automatically matched to 1S9C A:10-163
    mutant

Details for d1s9ci2

PDB Entry: 1s9c (more details), 3 Å

PDB Description: crystal structure analysis of the 2-enoyl-coa hydratase 2 domain of human peroxisomal multifunctional enzyme type 2
PDB Compounds: (I:) Peroxisomal multifunctional enzyme type 2

SCOP Domain Sequences for d1s9ci2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s9ci2 d.38.1.4 (I:10-163) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]}
aigqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptfgviigqksm
mggglaeipglsinfakvlhgeqylelykplpragklkceavvadvldkgsgvviimdvy
sysekelichnqfslflvgsggfggkrtsdkvkv

SCOP Domain Coordinates for d1s9ci2:

Click to download the PDB-style file with coordinates for d1s9ci2.
(The format of our PDB-style files is described here.)

Timeline for d1s9ci2: