Lineage for d1s9ci1 (1s9c I:164-289)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1023831Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1023832Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1023979Family d.38.1.4: MaoC-like [82636] (6 proteins)
  6. 1023984Protein 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase [102907] (2 species)
    duplication: consists of two MaoC-like domains; there is a greater structural divergence in the N-terminal domain
  7. 1023985Species Human (Homo sapiens) [TaxId:9606] [143168] (1 PDB entry)
    Uniprot P51659 326-479! Uniprot P51659 480-605
    the structure of N-terminal, SDR domain is also known, PDB entry 1ZBQ
  8. 1024002Domain d1s9ci1: 1s9c I:164-289 [118905]
    automatically matched to 1S9C A:164-289

Details for d1s9ci1

PDB Entry: 1s9c (more details), 3 Å

PDB Description: crystal structure analysis of the 2-enoyl-coa hydratase 2 domain of human peroxisomal multifunctional enzyme type 2
PDB Compounds: (I:) Peroxisomal multifunctional enzyme type 2

SCOPe Domain Sequences for d1s9ci1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s9ci1 d.38.1.4 (I:164-289) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]}
avaipnrppdavltdttslnqaalyrlsgdwnplhidpnfaslagfdkpilhglctfgfs
arrvlqqfadndvsrfkavkarfakpvypgqtlqtemwkegnrihfqtkvqetgdivisn
ayvdla

SCOPe Domain Coordinates for d1s9ci1:

Click to download the PDB-style file with coordinates for d1s9ci1.
(The format of our PDB-style files is described here.)

Timeline for d1s9ci1: