SCOP 1.73: Domain d1s8da2: 1s8d A:1-181

Lineage for d1s8da2 (1s8d A:1-181)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (62 PDB entries)

8. Domain d1s8da2: 1s8d A:1-181 [118887]
   Other proteins in same PDB: d1s8da1, d1s8db1
   automatically matched to d1akja2

Details for d1s8da2

PDB Entry: 1s8d, 2.2 Å

PDB Description: Structural basis for degenerate recognition of HIV peptide variants by cytotoxic lymphocyte, variant SL9-3A

PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOP Domain Sequences for d1s8da2:

Sequence; same for both SEQRES and ATOM records:

>d1s8da2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d1s8da2:

• d1s8da2 is new in SCOP 1.73
  
• d1s8da2 appears in SCOP 1.75
  
• d1s8da2 appears in the current release, SCOPe 2.08