![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (42 species) not a true protein |
![]() | Species Salmonella typhimurium [TaxId:99287] [186758] (4 PDB entries) |
![]() | Domain d1s7nd_: 1s7n D: [118883] automated match to d1nsla_ complexed with coa |
PDB Entry: 1s7n (more details), 2.1 Å
SCOPe Domain Sequences for d1s7nd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s7nd_ d.108.1.0 (D:) automated matches {Salmonella typhimurium [TaxId: 99287]} eiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqgnillh qrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqalmthya rrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyariidad
Timeline for d1s7nd_: