Lineage for d1s7nd_ (1s7n D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533769Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2533770Protein automated matches [190038] (46 species)
    not a true protein
  7. 2534010Species Salmonella typhimurium [TaxId:99287] [186758] (4 PDB entries)
  8. 2534015Domain d1s7nd_: 1s7n D: [118883]
    automated match to d1nsla_
    complexed with coa

Details for d1s7nd_

PDB Entry: 1s7n (more details), 2.1 Å

PDB Description: ribosomal l7/l12 alpha-n-protein acetyltransferase in complex with coenzyme a (coa free sulfhydryl)
PDB Compounds: (D:) acetyl transferase

SCOPe Domain Sequences for d1s7nd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7nd_ d.108.1.0 (D:) automated matches {Salmonella typhimurium [TaxId: 99287]}
eiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqgnillh
qrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqalmthya
rrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyariidad

SCOPe Domain Coordinates for d1s7nd_:

Click to download the PDB-style file with coordinates for d1s7nd_.
(The format of our PDB-style files is described here.)

Timeline for d1s7nd_: