| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
| Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
| Protein automated matches [190038] (49 species) not a true protein |
| Species Salmonella typhimurium [TaxId:99287] [186758] (4 PDB entries) |
| Domain d1s7nc_: 1s7n C: [118882] automated match to d1nsla_ complexed with coa |
PDB Entry: 1s7n (more details), 2.1 Å
SCOPe Domain Sequences for d1s7nc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s7nc_ d.108.1.0 (C:) automated matches {Salmonella typhimurium [TaxId: 99287]}
eiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqgnillh
qrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqalmthya
rrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyariida
Timeline for d1s7nc_: