Lineage for d1s7nb1 (1s7n B:1-176)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870001Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 870002Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (10 families) (S)
  5. 870003Family d.108.1.1: N-acetyl transferase, NAT [55730] (57 proteins)
  6. 870201Protein L7/L12-Ribosomal-protein-serine acetyltransferase RimL [143678] (1 species)
  7. 870202Species Salmonella typhimurium [TaxId:90371] [143679] (5 PDB entries)
    Uniprot Q8ZPC0 1-176
  8. 870205Domain d1s7nb1: 1s7n B:1-176 [118881]
    automatically matched to 1S7F A:1-176
    complexed with coa

Details for d1s7nb1

PDB Entry: 1s7n (more details), 2.1 Å

PDB Description: ribosomal l7/l12 alpha-n-protein acetyltransferase in complex with coenzyme a (coa free sulfhydryl)
PDB Compounds: (B:) acetyl transferase

SCOP Domain Sequences for d1s7nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7nb1 d.108.1.1 (B:1-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]}
mveiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqgnil
lhqrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqalmth
yarrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyarii

SCOP Domain Coordinates for d1s7nb1:

Click to download the PDB-style file with coordinates for d1s7nb1.
(The format of our PDB-style files is described here.)

Timeline for d1s7nb1: