SCOPe 2.03: Domain d1s7na_: 1s7n A:

Lineage for d1s7na_ (1s7n A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (22 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [186758] (4 PDB entries)

8. Domain d1s7na_: 1s7n A: [118880]
   automated match to d1nsla_
   complexed with coa

Details for d1s7na_

PDB Entry: 1s7n, 2.1 Å

PDB Description: ribosomal l7/l12 alpha-n-protein acetyltransferase in complex with coenzyme a (coa free sulfhydryl)

PDB Compounds: (A:) acetyl transferase

SCOPe Domain Sequences for d1s7na_:

Sequence; same for both SEQRES and ATOM records:

>d1s7na_ d.108.1.0 (A:) automated matches {Salmonella typhimurium [TaxId: 99287]}
veiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqgnill
hqrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqalmthy
arrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyariida

Timeline for d1s7na_:

• d1s7na_ first appeared in SCOP 1.73, called d1s7na1
  
• d1s7na_ appears in SCOPe 2.02
  
• d1s7na_ appears in SCOPe 2.04
  
• d1s7na_ appears in the current release, SCOPe 2.08