Lineage for d1s7la_ (1s7l A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209749Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2209750Protein automated matches [190038] (42 species)
    not a true protein
  7. 2209978Species Salmonella typhimurium [TaxId:99287] [186758] (4 PDB entries)
  8. 2209984Domain d1s7la_: 1s7l A: [118879]
    automated match to d1nsla_
    complexed with coa, so4

Details for d1s7la_

PDB Entry: 1s7l (more details), 2.3 Å

PDB Description: RimL- Ribosomal L7/L12 alpha-N-protein acetyltransferase in complex with Coenzyme A (CoA-Cys134 Disulfide)
PDB Compounds: (A:) acetyl transferase

SCOPe Domain Sequences for d1s7la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7la_ d.108.1.0 (A:) automated matches {Salmonella typhimurium [TaxId: 99287]}
eiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqgnillh
qrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqalmthya
rrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyariidad

SCOPe Domain Coordinates for d1s7la_:

Click to download the PDB-style file with coordinates for d1s7la_.
(The format of our PDB-style files is described here.)

Timeline for d1s7la_: