Lineage for d1s7ka_ (1s7k A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426873Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1426874Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1427400Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 1427401Protein automated matches [190038] (22 species)
    not a true protein
  7. 1427478Species Salmonella typhimurium [TaxId:99287] [186758] (4 PDB entries)
  8. 1427479Domain d1s7ka_: 1s7k A: [118878]
    automated match to d1nsla_

Details for d1s7ka_

PDB Entry: 1s7k (more details), 1.8 Å

PDB Description: RimL- Ribosomal L7/L12 alpha-N-protein acetyltransferase crystal form 2 (apo)
PDB Compounds: (A:) acetyl transferase

SCOPe Domain Sequences for d1s7ka_:

Sequence, based on SEQRES records: (download)

>d1s7ka_ d.108.1.0 (A:) automated matches {Salmonella typhimurium [TaxId: 99287]}
eiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqgnillh
qrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqalmthya
rrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyariidad

Sequence, based on observed residues (ATOM records): (download)

>d1s7ka_ d.108.1.0 (A:) automated matches {Salmonella typhimurium [TaxId: 99287]}
eiipvsttlelraadeshvpalhqlvlkntrkhvqgnillhqrgyakmylifcqnemagv
lsfnaiepinkaayigywldesfqgqgimsqslqalmthyarrgdirrfvikcrvdnqas
navarrnhftlegcmkqaeylngdyhdvnmyariidad

SCOPe Domain Coordinates for d1s7ka_:

Click to download the PDB-style file with coordinates for d1s7ka_.
(The format of our PDB-style files is described here.)

Timeline for d1s7ka_: