Lineage for d1s7ka1 (1s7k A:3-176)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731175Protein L7/L12-Ribosomal-protein-serine acetyltransferase RimL [143678] (1 species)
  7. 731176Species Salmonella typhimurium [TaxId:90371] [143679] (5 PDB entries)
  8. 731177Domain d1s7ka1: 1s7k A:3-176 [118878]
    automatically matched to 1S7F A:1-176

Details for d1s7ka1

PDB Entry: 1s7k (more details), 1.8 Å

PDB Description: RimL- Ribosomal L7/L12 alpha-N-protein acetyltransferase crystal form 2 (apo)
PDB Compounds: (A:) acetyl transferase

SCOP Domain Sequences for d1s7ka1:

Sequence, based on SEQRES records: (download)

>d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 602]}
eiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqgnillh
qrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqalmthya
rrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyarii

Sequence, based on observed residues (ATOM records): (download)

>d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 602]}
eiipvsttlelraadeshvpalhqlvlkntrkhvqgnillhqrgyakmylifcqnemagv
lsfnaiepinkaayigywldesfqgqgimsqslqalmthyarrgdirrfvikcrvdnqas
navarrnhftlegcmkqaeylngdyhdvnmyarii

SCOP Domain Coordinates for d1s7ka1:

Click to download the PDB-style file with coordinates for d1s7ka1.
(The format of our PDB-style files is described here.)

Timeline for d1s7ka1: