Lineage for d1s7fa1 (1s7f A:1-176)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533211Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2533413Protein L7/L12-Ribosomal-protein-serine acetyltransferase RimL [143678] (1 species)
  7. 2533414Species Salmonella typhimurium [TaxId:90371] [143679] (1 PDB entry)
    Uniprot Q8ZPC0 1-176
  8. 2533415Domain d1s7fa1: 1s7f A:1-176 [118877]
    Other proteins in same PDB: d1s7fa2
    complexed with cl, mla

Details for d1s7fa1

PDB Entry: 1s7f (more details), 2 Å

PDB Description: riml- ribosomal l7/l12 alpha-n-protein acetyltransferase crystal form i (apo)
PDB Compounds: (A:) acetyl transferase

SCOPe Domain Sequences for d1s7fa1:

Sequence, based on SEQRES records: (download)

>d1s7fa1 d.108.1.1 (A:1-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]}
mveiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqgnil
lhqrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqalmth
yarrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyarii

Sequence, based on observed residues (ATOM records): (download)

>d1s7fa1 d.108.1.1 (A:1-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]}
mveiipvsttlelraadeshvpalhqlvlknkawlqqsldwptsqeetrkhvqgnillhq
rgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqalmthyar
rgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyarii

SCOPe Domain Coordinates for d1s7fa1:

Click to download the PDB-style file with coordinates for d1s7fa1.
(The format of our PDB-style files is described here.)

Timeline for d1s7fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s7fa2