Lineage for d1s6ma_ (1s6m A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528607Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 2528608Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 2528689Family d.89.1.5: Relaxase domain [103120] (3 proteins)
    circular permutation of the common fold
    automatically mapped to Pfam PF08751
  6. 2528701Protein automated matches [190037] (1 species)
    not a true protein
  7. 2528702Species Escherichia coli [TaxId:562] [186757] (2 PDB entries)
  8. 2528703Domain d1s6ma_: 1s6m A: [118875]
    automated match to d1omha_
    protein/DNA complex; complexed with ni

Details for d1s6ma_

PDB Entry: 1s6m (more details), 2.28 Å

PDB Description: Conjugative Relaxase Trwc In Complex With Orit DNA. Metal-Bound Structure
PDB Compounds: (A:) TrwC

SCOPe Domain Sequences for d1s6ma_:

Sequence, based on SEQRES records: (download)

>d1s6ma_ d.89.1.5 (A:) automated matches {Escherichia coli [TaxId: 562]}
mlshmvltrqdigraasyyedgaddyyakdgdasewqgkgaeelglsgevdskrfrella
gnigeghrimrsatrqdskerigldltfsapksvslqalvagdaeiikahdravartleq
aearaqarqkiqgktriettgnlvigkfrhetsrerdpqlhthavilnmtkrsdgqwral
kndeivkatrylgavynaelahelqklgyqlrygkdgnfdlahidrqqiegfskrteqia
ewyaargldpnsvsleqkqaakvlsrakktsvdrealraewqatakelgidfs

Sequence, based on observed residues (ATOM records): (download)

>d1s6ma_ d.89.1.5 (A:) automated matches {Escherichia coli [TaxId: 562]}
mlshmvltrqdigraasyyedgaddydasewqgkgaeelglsgevdskrfrellagnige
ghrimrsatrqdskerigldltfsapksvslqalvagdaeiikahdravartleqaeara
qarqkiqgktriettgnlvigkfrhetsrerdpqlhthavilnmtkrsdgqwralkndei
vkatrylgavynaelahelqklgyqlrygkdgnfdlahidrqqiegfskrteqiaewyaa
rgldpnsvsleqkqaakvlsrakktsvdrealraewqatakelgidfs

SCOPe Domain Coordinates for d1s6ma_:

Click to download the PDB-style file with coordinates for d1s6ma_.
(The format of our PDB-style files is described here.)

Timeline for d1s6ma_: