Lineage for d1s62a_ (1s62 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1685927Fold d.212: TolA/TonB C-terminal domain [74652] (1 superfamily)
    beta(2)-alpha-beta; 2 layers, alpha/beta; left-handed beta-alpha-beta unit in non-swapped monomer
  4. 1685928Superfamily d.212.1: TolA/TonB C-terminal domain [74653] (2 families) (S)
  5. 1685929Family d.212.1.1: TolA [55217] (1 protein)
    contains extra N-terminal helix
  6. 1685930Protein TolA [55218] (2 species)
  7. 1685931Species Escherichia coli [TaxId:562] [55219] (2 PDB entries)
  8. 1685933Domain d1s62a_: 1s62 A: [118874]
    automated match to d1s62a1

Details for d1s62a_

PDB Entry: 1s62 (more details)

PDB Description: solution structure of the escherichia coli tola c-terminal domain
PDB Compounds: (A:) TolA protein

SCOPe Domain Sequences for d1s62a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s62a_ d.212.1.1 (A:) TolA {Escherichia coli [TaxId: 562]}
aefgntknngasgadinnyagqiksaieskfydassyagktctlriklapdgmlldikpe
ggdpalcqaalaaaklakipkppsqavyevfknapldfkphh

SCOPe Domain Coordinates for d1s62a_:

Click to download the PDB-style file with coordinates for d1s62a_.
(The format of our PDB-style files is described here.)

Timeline for d1s62a_: