Lineage for d1s62a2 (1s62 A:4-100)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563464Fold d.212: TolA/TonB C-terminal domain [74652] (1 superfamily)
    beta(2)-alpha-beta; 2 layers, alpha/beta; left-handed beta-alpha-beta unit in non-swapped monomer
  4. 2563465Superfamily d.212.1: TolA/TonB C-terminal domain [74653] (3 families) (S)
  5. 2563466Family d.212.1.1: TolA [55217] (2 proteins)
    contains extra N-terminal helix
  6. 2563467Protein TolA [55218] (2 species)
  7. 2563468Species Escherichia coli [TaxId:562] [55219] (2 PDB entries)
  8. 2563470Domain d1s62a2: 1s62 A:4-100 [118874]
    Other proteins in same PDB: d1s62a3, d1s62a4
    automated match to d1s62a1

Details for d1s62a2

PDB Entry: 1s62 (more details)

PDB Description: Solution structure of the Escherichia coli TolA C-terminal domain
PDB Compounds: (A:) TolA protein

SCOPe Domain Sequences for d1s62a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s62a2 d.212.1.1 (A:4-100) TolA {Escherichia coli [TaxId: 562]}
gntknngasgadinnyagqiksaieskfydassyagktctlriklapdgmlldikpeggd
palcqaalaaaklakipkppsqavyevfknapldfkp

SCOPe Domain Coordinates for d1s62a2:

Click to download the PDB-style file with coordinates for d1s62a2.
(The format of our PDB-style files is described here.)

Timeline for d1s62a2: