SCOPe 2.01: Domain d1s5zd_: 1s5z D:

Lineage for d1s5zd_ (1s5z D:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (8 species)
   not a true protein

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [186756] (2 PDB entries)

8. Domain d1s5zd_: 1s5z D: [118871]
   automated match to d1f6tb_
   complexed with po4, son

Details for d1s5zd_

PDB Entry: 1s5z, 2 Å

PDB Description: NDP kinase in complex with adenosine phosphonoacetic acid

PDB Compounds: (D:) Nucleoside diphosphate kinase, cytosolic

SCOPe Domain Sequences for d1s5zd_:

Sequence; same for both SEQRES and ATOM records:

>d1s5zd_ d.58.6.1 (D:) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
svesanreialwfkpeelltevkpnpnlye

Timeline for d1s5zd_:

• d1s5zd_ first appeared in SCOP 1.73, called d1s5zd1
  
• d1s5zd_ was called d1s5zd1 in SCOP 1.75
  
• d1s5zd_ appears in SCOPe 2.02
  
• d1s5zd_ appears in the current release, SCOPe 2.08