Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein) |
Protein Nucleoside diphosphate kinase, NDK [54921] (20 species) |
Species Dictyostelium discoideum [TaxId:44689] [54925] (22 PDB entries) |
Domain d1s5zd1: 1s5z D:6-155 [118871] automatically matched to d1f6tb_ complexed with po4, son |
PDB Entry: 1s5z (more details), 2 Å
SCOP Domain Sequences for d1s5zd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s5zd1 d.58.6.1 (D:6-155) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd svesanreialwfkpeelltevkpnpnlye
Timeline for d1s5zd1: